PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g12860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GRAS
Protein Properties Length: 564aa    MW: 62907.8 Da    PI: 4.8145
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g12860genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS443.12e-1351955633374
        GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 + L++cA a+++g+ e+a++++++l++++s +gdp++R aay++eALaar+a s+ +lykal+++e++   sse+l+a+++++ev+P+++f++++aN a
  CA04g12860 195 QMLFSCAAAIQDGNIEQASSVINELRQMVSIQGDPLERTAAYMVEALAARMATSGRGLYKALKCKEAT---SSERLSAMQVLFEVCPYFRFGFMAANGA 290
                 79*****************************************************************9...9*************************** PP

        GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 +lea++ e+rvHiiDfdi+qG Q+ ++lq+L s p++pp+lR+Tgv++pes      +l+ +g rLa++A+ l++pfef++ v ++++ +++ +L+++p
  CA04g12860 291 LLEAFKDEKRVHIIDFDINQGSQYYTFLQTLGSMPGKPPHLRLTGVDDPESIqrAVGSLNVIGLRLAELAKDLKIPFEFQA-VPSNTALVTPTMLKCRP 388
                 **************************************************99778899***********************.79*************** PP

        GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnv 297
                 gEa+ Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v+vveq++++n+++Fl+rf+e  +yysa+f+sl+a+l+r+s+er++vEr++l+r+i n+
  CA04g12860 389 GEAVLVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLNPKLVTVVEQDMNTNTAPFLQRFAEVYSYYSAVFESLDATLSRDSQERVNVERQCLARDIINI 487
                 *************************************************************************************************** PP

        GRAS 298 vacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 vaceg er+er e ++kWr+r+++aGF+p p+s ++++++k+l+++++++ y+ +ee g+l++gW+d++++++SaW+
  CA04g12860 488 VACEGLERIERYEVAGKWRARMMMAGFTPCPISRNVYDSIKTLIKQYSER-YTAKEEAGALYFGWEDKNMTVASAWK 563
                 ************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.624167544IPR005202Transcription factor GRAS
PfamPF035146.8E-133195563IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MSLVRSVRSI GNGKLYFPNG HNDNSSLSTS IYTKNARGIM YATESSSTDS YDPKYLLDSP  60
SPSEELLNIS PTDALGNPFH QRHSSSFQPS RDYNQGSCDS GDFVNQSPDS SEYNDGRVTM  120
KLQELERVLF DDNEIEGDDV CAHGETMDID DEWFSQIRTV LLQDSPKEST SADSNISSSS  180
SYKEISVTAP QTPKQMLFSC AAAIQDGNIE QASSVINELR QMVSIQGDPL ERTAAYMVEA  240
LAARMATSGR GLYKALKCKE ATSSERLSAM QVLFEVCPYF RFGFMAANGA LLEAFKDEKR  300
VHIIDFDINQ GSQYYTFLQT LGSMPGKPPH LRLTGVDDPE SIQRAVGSLN VIGLRLAELA  360
KDLKIPFEFQ AVPSNTALVT PTMLKCRPGE AVLVNFAFQL HHMPDESVST VNQRDQLLRM  420
VKSLNPKLVT VVEQDMNTNT APFLQRFAEV YSYYSAVFES LDATLSRDSQ ERVNVERQCL  480
ARDIINIVAC EGLERIERYE VAGKWRARMM MAGFTPCPIS RNVYDSIKTL IKQYSERYTA  540
KEEAGALYFG WEDKNMTVAS AWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-591955636375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016569609.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016569608.10.0PREDICTED: scarecrow-like protein 1
RefseqXP_016569607.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLQ00LP30.0Q00LP3_SOLLC; GRAS6
STRINGSolyc04g064550.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89672429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1